Lineage for d1suoa_ (1suo A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1743740Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 1743741Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 1743742Family a.104.1.1: Cytochrome P450 [48265] (23 proteins)
  6. 1744142Protein Mammalian cytochrome p450 2b4 [101375] (1 species)
  7. 1744143Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [101376] (10 PDB entries)
    Uniprot P00178
  8. 1744147Domain d1suoa_: 1suo A: [106026]
    complexed with cpz, hem

Details for d1suoa_

PDB Entry: 1suo (more details), 1.9 Å

PDB Description: structure of mammalian cytochrome p450 2b4 with bound 4-(4- chlorophenyl)imidazole
PDB Compounds: (A:) Cytochrome P450 2B4

SCOPe Domain Sequences for d1suoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1suoa_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
gklppgpsplpvlgnllqmdrkgllrsflrlrekygdvftvylgsrpvvvlcgtdairea
lvdqaeafsgrgkiavvdpifqgygvifangerwralrrfslatmrdfgmgkrsveeriq
eearclveelrkskgalldntllfhsitsniicsivfgkrfdykdpvflrlldlffqsfs
lissfssqvfelfsgflkyfpgthrqiyrnlqeintfigqsvekhratldpsnprdfidv
yllrmekdksdpssefhhqnliltvlslffagtettsttlrygfllmlkyphvtervqke
ieqvigshrppalddrakmpytdaviheiqrlgdlipfgvphtvtkdtqfrgyvipknte
vfpvlssalhdpryfetpntfnpghfldangalkrnegfmpfslgkriclgegiartelf
lffttilqnfsiaspvppedidltpresgvgnvppsyqirflarh

SCOPe Domain Coordinates for d1suoa_:

Click to download the PDB-style file with coordinates for d1suoa_.
(The format of our PDB-style files is described here.)

Timeline for d1suoa_: