Lineage for d1suoa_ (1suo A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 446992Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 446993Superfamily a.104.1: Cytochrome P450 [48264] (1 family) (S)
  5. 446994Family a.104.1.1: Cytochrome P450 [48265] (20 proteins)
  6. 447163Protein Mammalian cytochrome p450 2b4 [101375] (1 species)
  7. 447164Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [101376] (2 PDB entries)
  8. 447166Domain d1suoa_: 1suo A: [106026]

Details for d1suoa_

PDB Entry: 1suo (more details), 1.9 Å

PDB Description: Structure of mammalian cytochrome P450 2B4 with bound 4-(4-chlorophenyl)imidazole

SCOP Domain Sequences for d1suoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1suoa_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus)}
gklppgpsplpvlgnllqmdrkgllrsflrlrekygdvftvylgsrpvvvlcgtdairea
lvdqaeafsgrgkiavvdpifqgygvifangerwralrrfslatmrdfgmgkrsveeriq
eearclveelrkskgalldntllfhsitsniicsivfgkrfdykdpvflrlldlffqsfs
lissfssqvfelfsgflkyfpgthrqiyrnlqeintfigqsvekhratldpsnprdfidv
yllrmekdksdpssefhhqnliltvlslffagtettsttlrygfllmlkyphvtervqke
ieqvigshrppalddrakmpytdaviheiqrlgdlipfgvphtvtkdtqfrgyvipknte
vfpvlssalhdpryfetpntfnpghfldangalkrnegfmpfslgkriclgegiartelf
lffttilqnfsiaspvppedidltpresgvgnvppsyqirflarh

SCOP Domain Coordinates for d1suoa_:

Click to download the PDB-style file with coordinates for d1suoa_.
(The format of our PDB-style files is described here.)

Timeline for d1suoa_: