Lineage for d1suoa1 (1suo A:28-491)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2004933Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2005352Protein Mammalian cytochrome p450 2b4 [101375] (1 species)
  7. 2005353Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [101376] (10 PDB entries)
    Uniprot P00178
  8. 2005357Domain d1suoa1: 1suo A:28-491 [106026]
    Other proteins in same PDB: d1suoa2
    complexed with cpz, hem

Details for d1suoa1

PDB Entry: 1suo (more details), 1.9 Å

PDB Description: Structure of mammalian cytochrome P450 2B4 with bound 4-(4-chlorophenyl)imidazole
PDB Compounds: (A:) Cytochrome P450 2B4

SCOPe Domain Sequences for d1suoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1suoa1 a.104.1.1 (A:28-491) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
gklppgpsplpvlgnllqmdrkgllrsflrlrekygdvftvylgsrpvvvlcgtdairea
lvdqaeafsgrgkiavvdpifqgygvifangerwralrrfslatmrdfgmgkrsveeriq
eearclveelrkskgalldntllfhsitsniicsivfgkrfdykdpvflrlldlffqsfs
lissfssqvfelfsgflkyfpgthrqiyrnlqeintfigqsvekhratldpsnprdfidv
yllrmekdksdpssefhhqnliltvlslffagtettsttlrygfllmlkyphvtervqke
ieqvigshrppalddrakmpytdaviheiqrlgdlipfgvphtvtkdtqfrgyvipknte
vfpvlssalhdpryfetpntfnpghfldangalkrnegfmpfslgkriclgegiartelf
lffttilqnfsiaspvppedidltpresgvgnvppsyqirflar

SCOPe Domain Coordinates for d1suoa1:

Click to download the PDB-style file with coordinates for d1suoa1.
(The format of our PDB-style files is described here.)

Timeline for d1suoa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1suoa2