SCOP 1.75: Domain d1su5b_: 1su5 B:

Lineage for d1su5b_ (1su5 B:)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (1 family)

5. Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein)

6. Protein Triosephosphate isomerase [51353] (18 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [51354] (16 PDB entries)
   Uniprot P00940

8. Domain d1su5b_: 1su5 B: [106021]
   complexed with gol, pga, so4; mutant

Details for d1su5b_

PDB Entry: 1su5, 2.7 Å

PDB Description: understanding protein lids: structural analysis of active hinge mutants in triosephosphate isomerase

PDB Compounds: (B:) triosephosphate isomerase

SCOP Domain Sequences for d1su5b_:

Sequence; same for both SEQRES and ATOM records:

>d1su5b_ c.1.1.1 (B:) Triosephosphate isomerase {Chicken (Gallus gallus) [TaxId: 9031]}
aprkffvggnwkmngdkkslgelihtlngaklsadtevvcgapsiyldfarqkldakigv
aaqncykvpkgaftgeispamikdigaawvilghserrhvfgesdeligqkvahalaegl
gviacigekldereagitekvvfeqtkaiadnvkdwskvvlayepvwaigtgnpntpqqa
qevheklrgwlkshvsdavaqstriiyggsvtggnckelasqhdvdgflvggaslkpefv
diinakh

Timeline for d1su5b_:

• d1su5b_ first appeared in SCOP 1.69
  
• d1su5b_ appears in SCOP 1.73
  
• d1su5b_ appears in SCOPe 2.01
  
• d1su5b_ appears in the current release, SCOPe 2.08