Lineage for d1su1d_ (1su1 D:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 736785Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 736786Superfamily d.159.1: Metallo-dependent phosphatases [56300] (10 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 736895Family d.159.1.7: YfcE-like [111233] (3 proteins)
  6. 736896Protein Phosphodiesterase yfcE [111236] (1 species)
  7. 736897Species Escherichia coli [TaxId:562] [111237] (1 PDB entry)
  8. 736901Domain d1su1d_: 1su1 D: [106019]
    Structural genomics target
    complexed with so4, zn

Details for d1su1d_

PDB Entry: 1su1 (more details), 2.25 Å

PDB Description: structural and biochemical characterization of yfce, a phosphoesterase from e. coli
PDB Compounds: (D:) Hypothetical protein yfcE

SCOP Domain Sequences for d1su1d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1su1d_ d.159.1.7 (D:) Phosphodiesterase yfcE {Escherichia coli [TaxId: 562]}
mklmfasdihgslpatervlelfaqsgaqwlvilgdvlnhgprnalpegyapakvverln
evahkviavrgncdsevdqmllhfpitapwqqvllekqrlflthghlfgpenlpalnqnd
vlvyghthlpvaeqrgeifhfnpgsvsipkggnpasygmldndvlsvialndqsiiaqva
in

SCOP Domain Coordinates for d1su1d_:

Click to download the PDB-style file with coordinates for d1su1d_.
(The format of our PDB-style files is described here.)

Timeline for d1su1d_: