Lineage for d1su1d_ (1su1 D:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 613398Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 613399Superfamily d.159.1: Metallo-dependent phosphatases [56300] (9 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam 00149
  5. 613494Family d.159.1.7: YfcE-like [111233] (2 proteins)
  6. 613495Protein Phosphodiesterase yfcE [111236] (1 species)
  7. 613496Species Escherichia coli [TaxId:562] [111237] (1 PDB entry)
  8. 613500Domain d1su1d_: 1su1 D: [106019]
    Structural genomics target
    complexed with so4, zn

Details for d1su1d_

PDB Entry: 1su1 (more details), 2.25 Å

PDB Description: structural and biochemical characterization of yfce, a phosphoesterase from e. coli

SCOP Domain Sequences for d1su1d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1su1d_ d.159.1.7 (D:) Phosphodiesterase yfcE {Escherichia coli}
mklmfasdihgslpatervlelfaqsgaqwlvilgdvlnhgprnalpegyapakvverln
evahkviavrgncdsevdqmllhfpitapwqqvllekqrlflthghlfgpenlpalnqnd
vlvyghthlpvaeqrgeifhfnpgsvsipkggnpasygmldndvlsvialndqsiiaqva
in

SCOP Domain Coordinates for d1su1d_:

Click to download the PDB-style file with coordinates for d1su1d_.
(The format of our PDB-style files is described here.)

Timeline for d1su1d_: