Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily) 4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication |
Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) different families of this superfamily are groupped in a single Pfam family, Pfam PF00149 |
Family d.159.1.7: YfcE-like [111233] (5 proteins) |
Protein Phosphodiesterase yfcE [111236] (1 species) |
Species Escherichia coli [TaxId:562] [111237] (1 PDB entry) Uniprot P76495 |
Domain d1su1b_: 1su1 B: [106017] Structural genomics target complexed with so4, zn |
PDB Entry: 1su1 (more details), 2.25 Å
SCOPe Domain Sequences for d1su1b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1su1b_ d.159.1.7 (B:) Phosphodiesterase yfcE {Escherichia coli [TaxId: 562]} mmklmfasdihgslpatervlelfaqsgaqwlvilgdvlnhgprnalpegyapakvverl nevahkviavrgncdsevdqmllhfpitapwqqvllekqrlflthghlfgpenlpalnqn dvlvyghthlpvaeqrgeifhfnpgsvsipkggnpasygmldndvlsvialndqsiiaqv ainp
Timeline for d1su1b_: