SCOPe 2.04: Domain d1su1a_: 1su1 A:

Lineage for d1su1a_ (1su1 A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication

4. Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families)
   different families of this superfamily are groupped in a single Pfam family, Pfam PF00149

5. Family d.159.1.7: YfcE-like [111233] (5 proteins)

6. Protein Phosphodiesterase yfcE [111236] (1 species)

7. Species Escherichia coli [TaxId:562] [111237] (1 PDB entry)
   Uniprot P76495

8. Domain d1su1a_: 1su1 A: [106016]
   Structural genomics target
   complexed with so4, zn

Details for d1su1a_

PDB Entry: 1su1, 2.25 Å

PDB Description: structural and biochemical characterization of yfce, a phosphoesterase from e. coli

PDB Compounds: (A:) Hypothetical protein yfcE

SCOPe Domain Sequences for d1su1a_:

Sequence; same for both SEQRES and ATOM records:

>d1su1a_ d.159.1.7 (A:) Phosphodiesterase yfcE {Escherichia coli [TaxId: 562]}
mmklmfasdihgslpatervlelfaqsgaqwlvilgdvlnhgprnalpegyapakvverl
nevahkviavrgncdsevdqmllhfpitapwqqvllekqrlflthghlfgpenlpalnqn
dvlvyghthlpvaeqrgeifhfnpgsvsipkggnpasygmldndvlsvialndqsiiaqv
ainp

Timeline for d1su1a_:

• d1su1a_ first appeared in SCOP 1.69
  
• d1su1a_ appears in SCOPe 2.03
  
• d1su1a_ appears in SCOPe 2.05
  
• d1su1a_ appears in the current release, SCOPe 2.08