Lineage for d1su1a_ (1su1 A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 513455Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 513456Superfamily d.159.1: Metallo-dependent phosphatases [56300] (7 families) (S)
  5. 513548Family d.159.1.7: YfcE-like [111233] (2 proteins)
  6. 513549Protein Phosphodiesterase yfcE [111236] (1 species)
  7. 513550Species Escherichia coli [TaxId:562] [111237] (1 PDB entry)
  8. 513551Domain d1su1a_: 1su1 A: [106016]

Details for d1su1a_

PDB Entry: 1su1 (more details), 2.25 Å

PDB Description: structural and biochemical characterization of yfce, a phosphoesterase from e. coli

SCOP Domain Sequences for d1su1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1su1a_ d.159.1.7 (A:) Phosphodiesterase yfcE {Escherichia coli}
mmklmfasdihgslpatervlelfaqsgaqwlvilgdvlnhgprnalpegyapakvverl
nevahkviavrgncdsevdqmllhfpitapwqqvllekqrlflthghlfgpenlpalnqn
dvlvyghthlpvaeqrgeifhfnpgsvsipkggnpasygmldndvlsvialndqsiiaqv
ainp

SCOP Domain Coordinates for d1su1a_:

Click to download the PDB-style file with coordinates for d1su1a_.
(The format of our PDB-style files is described here.)

Timeline for d1su1a_: