Lineage for d1su1a_ (1su1 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2998036Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 2998037Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 2998354Family d.159.1.7: YfcE-like [111233] (5 proteins)
  6. 2998355Protein Phosphodiesterase yfcE [111236] (1 species)
  7. 2998356Species Escherichia coli [TaxId:562] [111237] (1 PDB entry)
    Uniprot P76495
  8. 2998357Domain d1su1a_: 1su1 A: [106016]
    Structural genomics target
    complexed with so4, zn

Details for d1su1a_

PDB Entry: 1su1 (more details), 2.25 Å

PDB Description: structural and biochemical characterization of yfce, a phosphoesterase from e. coli
PDB Compounds: (A:) Hypothetical protein yfcE

SCOPe Domain Sequences for d1su1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1su1a_ d.159.1.7 (A:) Phosphodiesterase yfcE {Escherichia coli [TaxId: 562]}
mmklmfasdihgslpatervlelfaqsgaqwlvilgdvlnhgprnalpegyapakvverl
nevahkviavrgncdsevdqmllhfpitapwqqvllekqrlflthghlfgpenlpalnqn
dvlvyghthlpvaeqrgeifhfnpgsvsipkggnpasygmldndvlsvialndqsiiaqv
ainp

SCOPe Domain Coordinates for d1su1a_:

Click to download the PDB-style file with coordinates for d1su1a_.
(The format of our PDB-style files is described here.)

Timeline for d1su1a_: