Lineage for d1stzc2 (1stz C:111-336)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1922390Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 1922459Superfamily d.110.2: GAF domain-like [55781] (5 families) (S)
    alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654
  5. 1922549Family d.110.2.3: HrcA C-terminal domain-like [111115] (1 protein)
    Pfam PF01628; contains insert domain (140-229) of the Enolase N-terminal domain-like fold (54825)
  6. 1922550Protein Heat-inducible transcription repressor HrcA, C-terminal domain [111116] (1 species)
  7. 1922551Species Thermotoga maritima [TaxId:2336] [111117] (1 PDB entry)
    Uniprot Q9WZV5
  8. 1922554Domain d1stzc2: 1stz C:111-336 [106014]
    Other proteins in same PDB: d1stza1, d1stzb1, d1stzc1
    Structural genomics target

Details for d1stzc2

PDB Entry: 1stz (more details), 2.2 Å

PDB Description: crystal structure of a hypothetical protein at 2.2 a resolution
PDB Compounds: (C:) Heat-inducible transcription repressor hrcA homolog

SCOPe Domain Sequences for d1stzc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1stzc2 d.110.2.3 (C:111-336) Heat-inducible transcription repressor HrcA, C-terminal domain {Thermotoga maritima [TaxId: 2336]}
mpladpekvlflagnllarltegyvlierpntrdlkilrvmlipvsedylifsiltefgv
skvtpiktqerlnweeierqlnfllrgrtvgevlmgkieslkgsgflrliesligetver
yldaglenllkdetltledirnlleevkdqkfleslvgegitvrigreigrkklekfavf
sgkyfkgespigsvylftskvtkydrnhrvfeyilnrlseyftsts

SCOPe Domain Coordinates for d1stzc2:

Click to download the PDB-style file with coordinates for d1stzc2.
(The format of our PDB-style files is described here.)

Timeline for d1stzc2: