Lineage for d1stzc1 (1stz C:11-95)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694229Family a.4.5.51: Heat-inducible transcription repressor HrcA, N-terminal domain [109683] (1 protein)
    similar domain organization to the transcriptional regulator IclR
  6. 2694230Protein Heat-inducible transcription repressor HrcA, N-terminal domain [109684] (1 species)
  7. 2694231Species Thermotoga maritima [TaxId:2336] [109685] (1 PDB entry)
    Uniprot Q9WZV5
  8. 2694234Domain d1stzc1: 1stz C:11-95 [106013]
    Other proteins in same PDB: d1stza2, d1stzb2, d1stzc2
    Structural genomics target

Details for d1stzc1

PDB Entry: 1stz (more details), 2.2 Å

PDB Description: crystal structure of a hypothetical protein at 2.2 a resolution
PDB Compounds: (C:) Heat-inducible transcription repressor hrcA homolog

SCOPe Domain Sequences for d1stzc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1stzc1 a.4.5.51 (C:11-95) Heat-inducible transcription repressor HrcA, N-terminal domain {Thermotoga maritima [TaxId: 2336]}
alkklndrqrkvlycivreyienkkpvssqrvlevsniefssatirndmkkleylgyiyq
phtsagriptdkglrfyyeemlkis

SCOPe Domain Coordinates for d1stzc1:

Click to download the PDB-style file with coordinates for d1stzc1.
(The format of our PDB-style files is described here.)

Timeline for d1stzc1: