Lineage for d1stzb2 (1stz B:111-336)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 509664Fold d.110: Profilin-like [55769] (7 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 509706Superfamily d.110.2: GAF domain-like [55781] (3 families) (S)
    alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654
  5. 509736Family d.110.2.3: HrcA C-terminal domain-like (Pfam 01628) [111115] (1 protein)
    contains insert domain (140-229) of the Enolase N-terminal domain-like fold (scop_cf 54825)
  6. 509737Protein Heat-inducible transcription repressor HrcA, C-terminal domain [111116] (1 species)
  7. 509738Species Thermotoga maritima [TaxId:243274] [111117] (1 PDB entry)
  8. 509740Domain d1stzb2: 1stz B:111-336 [106012]
    Other proteins in same PDB: d1stza1, d1stzb1, d1stzc1

Details for d1stzb2

PDB Entry: 1stz (more details), 2.2 Å

PDB Description: crystal structure of a hypothetical protein at 2.2 a resolution

SCOP Domain Sequences for d1stzb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1stzb2 d.110.2.3 (B:111-336) Heat-inducible transcription repressor HrcA, C-terminal domain {Thermotoga maritima}
mpladpekvlflagnllarltegyvlierpntrdlkilrvmlipvsedylifsiltefgv
skvtpiktqerlnweeierqlnfllrgrtvgevlmgkieslkgsgflrliesligetver
yldaglenllkdetltledirnlleevkdqkfleslvgegitvrigreigrkklekfavf
sgkyfkgespigsvylftskvtkydrnhrvfeyilnrlseyftsts

SCOP Domain Coordinates for d1stzb2:

Click to download the PDB-style file with coordinates for d1stzb2.
(The format of our PDB-style files is described here.)

Timeline for d1stzb2: