SCOPe 2.08: Domain d1stzb2: 1stz B:111-336

Lineage for d1stzb2 (1stz B:111-336)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.2: GAF domain-like [55781] (5 families)
   alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654

5. Family d.110.2.3: HrcA C-terminal domain-like [111115] (1 protein)
   Pfam PF01628; contains insert domain (140-229) of the Enolase N-terminal domain-like fold (54825)

6. Protein Heat-inducible transcription repressor HrcA, C-terminal domain [111116] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [111117] (1 PDB entry)
   Uniprot Q9WZV5

8. Domain d1stzb2: 1stz B:111-336 [106012]
   Other proteins in same PDB: d1stza1, d1stzb1, d1stzc1
   Structural genomics target

Details for d1stzb2

PDB Entry: 1stz, 2.2 Å

PDB Description: crystal structure of a hypothetical protein at 2.2 a resolution

PDB Compounds: (B:) Heat-inducible transcription repressor hrcA homolog

SCOPe Domain Sequences for d1stzb2:

Sequence; same for both SEQRES and ATOM records:

>d1stzb2 d.110.2.3 (B:111-336) Heat-inducible transcription repressor HrcA, C-terminal domain {Thermotoga maritima [TaxId: 2336]}
mpladpekvlflagnllarltegyvlierpntrdlkilrvmlipvsedylifsiltefgv
skvtpiktqerlnweeierqlnfllrgrtvgevlmgkieslkgsgflrliesligetver
yldaglenllkdetltledirnlleevkdqkfleslvgegitvrigreigrkklekfavf
sgkyfkgespigsvylftskvtkydrnhrvfeyilnrlseyftsts

Timeline for d1stzb2:

• d1stzb2 first appeared in SCOP 1.69
  
• d1stzb2 appears in SCOPe 2.07