![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
![]() | Superfamily d.110.2: GAF domain-like [55781] (5 families) ![]() alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654 |
![]() | Family d.110.2.3: HrcA C-terminal domain-like [111115] (1 protein) Pfam PF01628; contains insert domain (140-229) of the Enolase N-terminal domain-like fold (54825) |
![]() | Protein Heat-inducible transcription repressor HrcA, C-terminal domain [111116] (1 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [111117] (1 PDB entry) Uniprot Q9WZV5 |
![]() | Domain d1stzb2: 1stz B:111-336 [106012] Other proteins in same PDB: d1stza1, d1stzb1, d1stzc1 Structural genomics target |
PDB Entry: 1stz (more details), 2.2 Å
SCOPe Domain Sequences for d1stzb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1stzb2 d.110.2.3 (B:111-336) Heat-inducible transcription repressor HrcA, C-terminal domain {Thermotoga maritima [TaxId: 2336]} mpladpekvlflagnllarltegyvlierpntrdlkilrvmlipvsedylifsiltefgv skvtpiktqerlnweeierqlnfllrgrtvgevlmgkieslkgsgflrliesligetver yldaglenllkdetltledirnlleevkdqkfleslvgegitvrigreigrkklekfavf sgkyfkgespigsvylftskvtkydrnhrvfeyilnrlseyftsts
Timeline for d1stzb2:
![]() Domains from other chains: (mouse over for more information) d1stza1, d1stza2, d1stzc1, d1stzc2 |