SCOPe 2.06: Domain d1stzb1: 1stz B:11-95

Lineage for d1stzb1 (1stz B:11-95)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.51: Heat-inducible transcription repressor HrcA, N-terminal domain [109683] (1 protein)
   similar domain organization to the transcriptional regulator IclR

6. Protein Heat-inducible transcription repressor HrcA, N-terminal domain [109684] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [109685] (1 PDB entry)
   Uniprot Q9WZV5

8. Domain d1stzb1: 1stz B:11-95 [106011]
   Other proteins in same PDB: d1stza2, d1stzb2, d1stzc2
   Structural genomics target

Details for d1stzb1

PDB Entry: 1stz, 2.2 Å

PDB Description: crystal structure of a hypothetical protein at 2.2 a resolution

PDB Compounds: (B:) Heat-inducible transcription repressor hrcA homolog

SCOPe Domain Sequences for d1stzb1:

Sequence; same for both SEQRES and ATOM records:

>d1stzb1 a.4.5.51 (B:11-95) Heat-inducible transcription repressor HrcA, N-terminal domain {Thermotoga maritima [TaxId: 2336]}
alkklndrqrkvlycivreyienkkpvssqrvlevsniefssatirndmkkleylgyiyq
phtsagriptdkglrfyyeemlkis

Timeline for d1stzb1:

• d1stzb1 first appeared in SCOP 1.69
  
• d1stzb1 appears in SCOPe 2.05
  
• d1stzb1 appears in SCOPe 2.07
  
• d1stzb1 appears in the current release, SCOPe 2.08