![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.51: Heat-inducible transcription repressor HrcA, N-terminal domain [109683] (1 protein) similar domain organization to the transcriptional regulator IclR |
![]() | Protein Heat-inducible transcription repressor HrcA, N-terminal domain [109684] (1 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [109685] (1 PDB entry) Uniprot Q9WZV5 |
![]() | Domain d1stzb1: 1stz B:11-95 [106011] Other proteins in same PDB: d1stza2, d1stzb2, d1stzc2 Structural genomics target |
PDB Entry: 1stz (more details), 2.2 Å
SCOPe Domain Sequences for d1stzb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1stzb1 a.4.5.51 (B:11-95) Heat-inducible transcription repressor HrcA, N-terminal domain {Thermotoga maritima [TaxId: 2336]} alkklndrqrkvlycivreyienkkpvssqrvlevsniefssatirndmkkleylgyiyq phtsagriptdkglrfyyeemlkis
Timeline for d1stzb1:
![]() Domains from other chains: (mouse over for more information) d1stza1, d1stza2, d1stzc1, d1stzc2 |