Lineage for d1stza1 (1stz A:14-100)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 438099Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (13 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 438531Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (55 families) (S)
    contains a small beta-sheet (wing)
  5. 439140Family a.4.5.51: Heat-inducible transcription repressor HrcA, N-terminal domain [109683] (1 protein)
    similar domain organization to the transcriptional regulator IclR
  6. 439141Protein Heat-inducible transcription repressor HrcA, N-terminal domain [109684] (1 species)
  7. 439142Species Thermotoga maritima [TaxId:243274] [109685] (1 PDB entry)
  8. 439143Domain d1stza1: 1stz A:14-100 [106009]
    Other proteins in same PDB: d1stza2, d1stzb2, d1stzc2

Details for d1stza1

PDB Entry: 1stz (more details), 2.2 Å

PDB Description: crystal structure of a hypothetical protein at 2.2 a resolution

SCOP Domain Sequences for d1stza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1stza1 a.4.5.51 (A:14-100) Heat-inducible transcription repressor HrcA, N-terminal domain {Thermotoga maritima}
klndrqrkvlycivreyienkkpvssqrvlevsniefssatirndmkkleylgyiyqpht
sagriptdkglrfyyeemlkisketse

SCOP Domain Coordinates for d1stza1:

Click to download the PDB-style file with coordinates for d1stza1.
(The format of our PDB-style files is described here.)

Timeline for d1stza1: