Lineage for d1stza1 (1stz A:14-100)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982196Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1983373Family a.4.5.51: Heat-inducible transcription repressor HrcA, N-terminal domain [109683] (1 protein)
    similar domain organization to the transcriptional regulator IclR
  6. 1983374Protein Heat-inducible transcription repressor HrcA, N-terminal domain [109684] (1 species)
  7. 1983375Species Thermotoga maritima [TaxId:2336] [109685] (1 PDB entry)
    Uniprot Q9WZV5
  8. 1983376Domain d1stza1: 1stz A:14-100 [106009]
    Other proteins in same PDB: d1stza2, d1stzb2, d1stzc2
    Structural genomics target

Details for d1stza1

PDB Entry: 1stz (more details), 2.2 Å

PDB Description: Crystal structure of a hypothetical protein at 2.2 A resolution
PDB Compounds: (A:) Heat-inducible transcription repressor hrcA homolog

SCOPe Domain Sequences for d1stza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1stza1 a.4.5.51 (A:14-100) Heat-inducible transcription repressor HrcA, N-terminal domain {Thermotoga maritima [TaxId: 2336]}
klndrqrkvlycivreyienkkpvssqrvlevsniefssatirndmkkleylgyiyqpht
sagriptdkglrfyyeemlkisketse

SCOPe Domain Coordinates for d1stza1:

Click to download the PDB-style file with coordinates for d1stza1.
(The format of our PDB-style files is described here.)

Timeline for d1stza1: