SCOP 1.69: Domain d1st6a6: 1st6 A:647-718

Lineage for d1st6a6 (1st6 A:647-718)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (23 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.9: alpha-catenin/vinculin [47220] (1 family)

5. Family a.24.9.1: alpha-catenin/vinculin [47221] (2 proteins)
   possible duplication: contains several domains of this fold
   The listed PDB entries contain different large fragments but not the whole proteins

6. Protein Vinculin [47224] (2 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [47225] (3 PDB entries)

8. Domain d1st6a6: 1st6 A:647-718 [106005]

Details for d1st6a6

PDB Entry: 1st6, 3.1 Å

PDB Description: Crystal structure of a cytoskeletal protein

SCOP Domain Sequences for d1st6a6:

Sequence; same for both SEQRES and ATOM records:

>d1st6a6 a.24.9.1 (A:647-718) Vinculin {Chicken (Gallus gallus)}
aaavgtankttvegiqatvksareltpqvvsaarillrnpgnqaayehfetmknqwidnv
ekmtglvdeaid

Timeline for d1st6a6:

• d1st6a6 is new in SCOP 1.69
  
• d1st6a6 appears in SCOP 1.71
  
• d1st6a6 appears in the current release, SCOPe 2.08