SCOPe 2.06: Domain d1st6a5: 1st6 A:489-646

Lineage for d1st6a5 (1st6 A:489-646)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.9: alpha-catenin/vinculin-like [47220] (2 families)

5. Family a.24.9.1: alpha-catenin/vinculin [47221] (3 proteins)
   possible duplication: contains several domains of this fold
   The listed PDB entries contain different large fragments but not the whole proteins

6. Protein Vinculin [47224] (2 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [47225] (3 PDB entries)
   Uniprot P12003

8. Domain d1st6a5: 1st6 A:489-646 [106004]
   Other proteins in same PDB: d1st6a9
   full-length protein containing eight four-helix bundle domains

Details for d1st6a5

PDB Entry: 1st6, 3.1 Å

PDB Description: Crystal structure of a cytoskeletal protein

PDB Compounds: (A:) vinculin

SCOPe Domain Sequences for d1st6a5:

Sequence; same for both SEQRES and ATOM records:

>d1st6a5 a.24.9.1 (A:489-646) Vinculin {Chicken (Gallus gallus) [TaxId: 9031]}
aavhlegkieqaqrwidnptvddrgvgqaairglvaegrrlanvmmgpyrqdllakcdrv
dqlaaqladlaargegespqaraiaaqlqdslkdlkarmqeamtqevsdvfsdtttpikl
lavaatapsdtpnreevfeeraanfenhaarlgataek

Timeline for d1st6a5:

• d1st6a5 first appeared in SCOP 1.69
  
• d1st6a5 appears in SCOPe 2.05
  
• d1st6a5 appears in SCOPe 2.07
  
• d1st6a5 appears in the current release, SCOPe 2.08