Lineage for d1ssza_ (1ssz A:)

  1. Root: SCOP 1.69
  2. 528313Class j: Peptides [58231] (116 folds)
  3. 529025Fold j.35: Transmembrane helical fragments [58517] (1 superfamily)
  4. 529026Superfamily j.35.1: Transmembrane helical fragments [58518] (1 family) (S)
  5. 529027Family j.35.1.1: Transmembrane helical fragments [58519] (28 proteins)
    the member of this family may be not related
  6. 529116Protein N-terminal segment of surfactant protein B [58528] (1 species)
  7. 529117Species Synthetic, based on Homo sapiens sequence [58529] (5 PDB entries)
  8. 529122Domain d1ssza_: 1ssz A: [105999]

Details for d1ssza_

PDB Entry: 1ssz (more details)

PDB Description: conformational mapping of mini-b: an n-terminal/c-terminal construct of surfactant protein b using 13c-enhanced fourier transform infrared (ftir) spectroscopy

SCOP Domain Sequences for d1ssza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ssza_ j.35.1.1 (A:) N-terminal segment of surfactant protein B {Synthetic, based on Homo sapiens sequence}
cwlcralikriqamipkggrmlpqlvcrlvlrcs

SCOP Domain Coordinates for d1ssza_:

Click to download the PDB-style file with coordinates for d1ssza_.
(The format of our PDB-style files is described here.)

Timeline for d1ssza_: