![]() | Class j: Peptides [58231] (151 folds) |
![]() | Fold j.35: Transmembrane helical fragments [58517] (1 superfamily) |
![]() | Superfamily j.35.1: Transmembrane helical fragments [58518] (1 family) ![]() |
![]() | Family j.35.1.1: Transmembrane helical fragments [58519] (30 proteins) the member of this family may be not related |
![]() | Protein Surfactant Protein B (SP-B) miniprotein constructs [58528] (1 species) |
![]() | Species Synthetic, based on Homo sapiens sequence [58529] (7 PDB entries) Uniprot P07988 208-225,263-278 |
![]() | Domain d1ssza_: 1ssz A: [105999] mini-B: an N-terminal/C-terminal construct |
PDB Entry: 1ssz (more details)
SCOPe Domain Sequences for d1ssza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ssza_ j.35.1.1 (A:) Surfactant Protein B (SP-B) miniprotein constructs {Synthetic, based on Homo sapiens sequence} cwlcralikriqamipkggrmlpqlvcrlvlrcs
Timeline for d1ssza_: