Lineage for d1ssza_ (1ssz A:)

  1. Root: SCOPe 2.08
  2. 3045664Class j: Peptides [58231] (151 folds)
  3. 3046491Fold j.35: Transmembrane helical fragments [58517] (1 superfamily)
  4. 3046492Superfamily j.35.1: Transmembrane helical fragments [58518] (1 family) (S)
  5. 3046493Family j.35.1.1: Transmembrane helical fragments [58519] (30 proteins)
    the member of this family may be not related
  6. 3046626Protein Surfactant Protein B (SP-B) miniprotein constructs [58528] (1 species)
  7. 3046627Species Synthetic, based on Homo sapiens sequence [58529] (7 PDB entries)
    Uniprot P07988 208-225,263-278
  8. 3046634Domain d1ssza_: 1ssz A: [105999]
    mini-B: an N-terminal/C-terminal construct

Details for d1ssza_

PDB Entry: 1ssz (more details)

PDB Description: conformational mapping of mini-b: an n-terminal/c-terminal construct of surfactant protein b using 13c-enhanced fourier transform infrared (ftir) spectroscopy
PDB Compounds: (A:) Pulmonary surfactant-associated protein B

SCOPe Domain Sequences for d1ssza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ssza_ j.35.1.1 (A:) Surfactant Protein B (SP-B) miniprotein constructs {Synthetic, based on Homo sapiens sequence}
cwlcralikriqamipkggrmlpqlvcrlvlrcs

SCOPe Domain Coordinates for d1ssza_:

Click to download the PDB-style file with coordinates for d1ssza_.
(The format of our PDB-style files is described here.)

Timeline for d1ssza_: