Lineage for d1ssua_ (1ssu A:)

  1. Root: SCOP 1.69
  2. 520835Class g: Small proteins [56992] (75 folds)
  3. 524852Fold g.64: Somatomedin B domain [90187] (1 superfamily)
    disulfide-rich
  4. 524853Superfamily g.64.1: Somatomedin B domain [90188] (1 family) (S)
  5. 524854Family g.64.1.1: Somatomedin B domain [90189] (1 protein)
  6. 524855Protein Vitronectin [90190] (1 species)
  7. 524856Species Human (Homo sapiens) [TaxId:9606] [90191] (3 PDB entries)
  8. 524858Domain d1ssua_: 1ssu A: [105998]

Details for d1ssua_

PDB Entry: 1ssu (more details)

PDB Description: structural and biochemical evidence for disulfide bond heterogeneity in active forms of the somatomedin b domain of human vitronectin

SCOP Domain Sequences for d1ssua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ssua_ g.64.1.1 (A:) Vitronectin {Human (Homo sapiens)}
dqesckgrctegfnvdkkcqcdelcsyyqscctdytaeckpqvtrgdvftm

SCOP Domain Coordinates for d1ssua_:

Click to download the PDB-style file with coordinates for d1ssua_.
(The format of our PDB-style files is described here.)

Timeline for d1ssua_: