SCOPe 2.08: Domain d1ssua_: 1ssu A:

Lineage for d1ssua_ (1ssu A:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.64: Somatomedin B domain [90187] (1 superfamily)
   disulfide-rich

4. Superfamily g.64.1: Somatomedin B domain [90188] (1 family)
   automatically mapped to Pfam PF01033

5. Family g.64.1.1: Somatomedin B domain [90189] (1 protein)

6. Protein Vitronectin [90190] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [90191] (6 PDB entries)
   Uniprot P04004 20-70

8. Domain d1ssua_: 1ssu A: [105998]

Details for d1ssua_

PDB Entry: 1ssu

PDB Description: structural and biochemical evidence for disulfide bond heterogeneity in active forms of the somatomedin b domain of human vitronectin

PDB Compounds: (A:) Vitronectin

SCOPe Domain Sequences for d1ssua_:

Sequence; same for both SEQRES and ATOM records:

>d1ssua_ g.64.1.1 (A:) Vitronectin {Human (Homo sapiens) [TaxId: 9606]}
dqesckgrctegfnvdkkcqcdelcsyyqscctdytaeckpqvtrgdvftm

Timeline for d1ssua_:

• d1ssua_ first appeared in SCOP 1.69
  
• d1ssua_ appears in SCOPe 2.07