Lineage for d1sstb_ (1sst B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2069505Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2069506Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 2069727Family b.81.1.6: Serine acetyltransferase [110309] (2 protein domains)
  6. 2069728Protein Serine acetyltransferase [110310] (2 species)
    extra N-terminal all-alpha subdomain belongs to Pfam PF06426
  7. 2069733Species Haemophilus influenzae [TaxId:727] [110311] (4 PDB entries)
    Uniprot P43886 1-241
  8. 2069737Domain d1sstb_: 1sst B: [105996]
    complexed with coa

Details for d1sstb_

PDB Entry: 1sst (more details), 2 Å

PDB Description: Serine Acetyltransferase- Complex with CoA
PDB Compounds: (B:) Serine acetyltransferase

SCOPe Domain Sequences for d1sstb_:

Sequence, based on SEQRES records: (download)

>d1sstb_ b.81.1.6 (B:) Serine acetyltransferase {Haemophilus influenzae [TaxId: 727]}
mtldvwqhirqeakelaenepmlasffhstilkhqnlggalsyllanklanpimpaislr
eiieeayqsnpsiidcaacdiqavrhrdpavelwstpllylkgfhaiqsyrithylwnqn
rkslalylqnqisvafdvdihpaakighgimfdhatgivvgetsviendvsilqgvtlgg
tgkesgdrhpkvregvmigagakilgnievgkyakigansvvlnpvpeyataagvpariv

Sequence, based on observed residues (ATOM records): (download)

>d1sstb_ b.81.1.6 (B:) Serine acetyltransferase {Haemophilus influenzae [TaxId: 727]}
mtldvwqhirqeakelaenepmlasffhstilkhqnlggalsyllanklanpimpaislr
eiieeayqsnpsiidcaacdiqavrhrdpavelwstpllylkgfhaiqsyrithylwnqn
rkslalylqnqisvafdvdihpaakighgimfdhatgivvgetsviendvsilqgvtlgg
tdrhpkvregvmigagakilgnievgkyakigansvvlnpvpeyataagvpariv

SCOPe Domain Coordinates for d1sstb_:

Click to download the PDB-style file with coordinates for d1sstb_.
(The format of our PDB-style files is described here.)

Timeline for d1sstb_: