Lineage for d1ssta_ (1sst A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2423278Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2423279Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 2423550Family b.81.1.6: Serine acetyltransferase [110309] (2 proteins)
    this is a repeat family; one repeat unit is 1t3d A:205-223 found in domain
  6. 2423551Protein Serine acetyltransferase [110310] (2 species)
    extra N-terminal all-alpha subdomain belongs to Pfam PF06426
  7. 2423556Species Haemophilus influenzae [TaxId:727] [110311] (4 PDB entries)
    Uniprot P43886 1-241
  8. 2423559Domain d1ssta_: 1sst A: [105995]
    complexed with coa

Details for d1ssta_

PDB Entry: 1sst (more details), 2 Å

PDB Description: Serine Acetyltransferase- Complex with CoA
PDB Compounds: (A:) Serine acetyltransferase

SCOPe Domain Sequences for d1ssta_:

Sequence, based on SEQRES records: (download)

>d1ssta_ b.81.1.6 (A:) Serine acetyltransferase {Haemophilus influenzae [TaxId: 727]}
mtldvwqhirqeakelaenepmlasffhstilkhqnlggalsyllanklanpimpaislr
eiieeayqsnpsiidcaacdiqavrhrdpavelwstpllylkgfhaiqsyrithylwnqn
rkslalylqnqisvafdvdihpaakighgimfdhatgivvgetsviendvsilqgvtlgg
tgkesgdrhpkvregvmigagakilgnievgkyakigansvvlnpvpeyataagvpariv

Sequence, based on observed residues (ATOM records): (download)

>d1ssta_ b.81.1.6 (A:) Serine acetyltransferase {Haemophilus influenzae [TaxId: 727]}
mtldvwqhirqeakelaenepmlasffhstilkhqnlggalsyllanklanpimpaislr
eiieeayqsnpsiidcaacdiqavrhrdpavelwstpllylkgfhaiqsyrithylwnqn
rkslalylqnqisvafdvdihpaakighgimfdhatgivvgetsviendvsilqgvtlgg
thpkvregvmigagakilgnievgkyakigansvvlnpvpeyataagvpariv

SCOPe Domain Coordinates for d1ssta_:

Click to download the PDB-style file with coordinates for d1ssta_.
(The format of our PDB-style files is described here.)

Timeline for d1ssta_: