![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
![]() | Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) ![]() superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands |
![]() | Family b.81.1.6: Serine acetyltransferase [110309] (2 proteins) this is a repeat family; one repeat unit is 1t3d A:205-223 found in domain |
![]() | Protein Serine acetyltransferase [110310] (2 species) extra N-terminal all-alpha subdomain belongs to Pfam PF06426 |
![]() | Species Haemophilus influenzae [TaxId:727] [110311] (4 PDB entries) Uniprot P43886 1-241 |
![]() | Domain d1ssqa_: 1ssq A: [105993] complexed with cys, mg |
PDB Entry: 1ssq (more details), 1.85 Å
SCOPe Domain Sequences for d1ssqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ssqa_ b.81.1.6 (A:) Serine acetyltransferase {Haemophilus influenzae [TaxId: 727]} mnldvwqhirqeakelaenepmlasffhstilkhqnlggalsyllanklanpimpaislr eiieeayqsnpsiidcaacdiqavrhrdpavelwstpllylkgfhaiqsyrithylwnqn rkslalylqnqisvafdvdihpaakighgimfdhatgivvgetsviendvsilqgvtlgg tgkesgdrhpkvregvmigagakilgnievgkyakigansvvlnpvpeyataagvpariv s
Timeline for d1ssqa_: