Lineage for d1ssqa_ (1ssq A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 809516Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 809517Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (8 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 809668Family b.81.1.6: Serine acetyltransferase [110309] (1 protein)
    this is a repeat family; one repeat unit is 1t3d A:205-223 found in domain
  6. 809669Protein Serine acetyltransferase [110310] (2 species)
    extra N-terminal all-alpha subdomain belongs to Pfam PF06426
  7. 809674Species Haemophilus influenzae [TaxId:727] [110311] (4 PDB entries)
    Uniprot P43886 1-241
  8. 809675Domain d1ssqa_: 1ssq A: [105993]

Details for d1ssqa_

PDB Entry: 1ssq (more details), 1.85 Å

PDB Description: serine acetyltransferase- complex with cysteine
PDB Compounds: (A:) Serine acetyltransferase

SCOP Domain Sequences for d1ssqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ssqa_ b.81.1.6 (A:) Serine acetyltransferase {Haemophilus influenzae [TaxId: 727]}
mnldvwqhirqeakelaenepmlasffhstilkhqnlggalsyllanklanpimpaislr
eiieeayqsnpsiidcaacdiqavrhrdpavelwstpllylkgfhaiqsyrithylwnqn
rkslalylqnqisvafdvdihpaakighgimfdhatgivvgetsviendvsilqgvtlgg
tgkesgdrhpkvregvmigagakilgnievgkyakigansvvlnpvpeyataagvpariv
s

SCOP Domain Coordinates for d1ssqa_:

Click to download the PDB-style file with coordinates for d1ssqa_.
(The format of our PDB-style files is described here.)

Timeline for d1ssqa_: