Lineage for d1ssmb_ (1ssm B:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 677067Fold b.81: Single-stranded left-handed beta-helix [51160] (3 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 677068Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (7 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 677217Family b.81.1.6: Serine acetyltransferase [110309] (1 protein)
    this is a repeat family; one repeat unit is 1t3d A:205-223 found in domain
  6. 677218Protein Serine acetyltransferase [110310] (2 species)
    extra N-terminal all-alpha subdomain belongs to Pfam PF06426
  7. 677223Species Haemophilus influenzae [TaxId:727] [110311] (4 PDB entries)
  8. 677227Domain d1ssmb_: 1ssm B: [105988]

Details for d1ssmb_

PDB Entry: 1ssm (more details), 2.15 Å

PDB Description: Serine Acetyltransferase- Apoenzyme (truncated)
PDB Compounds: (B:) Serine acetyltransferase

SCOP Domain Sequences for d1ssmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ssmb_ b.81.1.6 (B:) Serine acetyltransferase {Haemophilus influenzae [TaxId: 727]}
mtldvwqhirqeakelaenepmlasffhstilkhqnlggalsyllanklanpimpaislr
eiieeayqsnpsiidcaacdiqavrhrdpavelwstpllylkgfhaiqsyrithylwnqn
rkslalylqnqisvafdvdihpaakighgimfdhatgivvgetsviendvsilqgvtlgg
tgkesgdrhpkvregvmigagakilgnievgkyakigansvvlnpvpeyataagvpariv

SCOP Domain Coordinates for d1ssmb_:

Click to download the PDB-style file with coordinates for d1ssmb_.
(The format of our PDB-style files is described here.)

Timeline for d1ssmb_: