Lineage for d1ssmb_ (1ssm B:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. Family b.81.1.6: Serine acetyltransferase [110309] (2 proteins)
  6. Protein Serine acetyltransferase [110310] (2 species)
    extra N-terminal all-alpha subdomain belongs to Pfam PF06426
  7. Species Haemophilus influenzae [TaxId:727] [110311] (4 PDB entries)
    Uniprot P43886 1-241
  8. Domain d1ssmb_: 1ssm B: [105988]

Details for d1ssmb_

PDB Entry: 1ssm (more details), 2.15 Å

PDB Description: Serine Acetyltransferase- Apoenzyme (truncated)
PDB Compounds: (B:) Serine acetyltransferase

SCOPe Domain Sequences for d1ssmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ssmb_ b.81.1.6 (B:) Serine acetyltransferase {Haemophilus influenzae [TaxId: 727]}
mtldvwqhirqeakelaenepmlasffhstilkhqnlggalsyllanklanpimpaislr
eiieeayqsnpsiidcaacdiqavrhrdpavelwstpllylkgfhaiqsyrithylwnqn
rkslalylqnqisvafdvdihpaakighgimfdhatgivvgetsviendvsilqgvtlgg
tgkesgdrhpkvregvmigagakilgnievgkyakigansvvlnpvpeyataagvpariv

SCOPe Domain Coordinates for d1ssmb_ are not available.

Timeline for d1ssmb_:

Domains from other chains:
(mouse over for more information)
d1ssma_, d1ssmc_, d1ssmd_, d1ssme_, d1ssmf_