Lineage for d1ssma_ (1ssm A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 470408Fold b.81: Single-stranded left-handed beta-helix [51160] (3 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 470409Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (6 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 470521Family b.81.1.6: Serine acetyltransferase [110309] (1 protein)
  6. 470522Protein Serine acetyltransferase [110310] (2 species)
  7. 470527Species Haemophilus influenzae [TaxId:727] [110311] (4 PDB entries)
  8. 470530Domain d1ssma_: 1ssm A: [105987]

Details for d1ssma_

PDB Entry: 1ssm (more details), 2.15 Å

PDB Description: Serine Acetyltransferase- Apoenzyme (truncated)

SCOP Domain Sequences for d1ssma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ssma_ b.81.1.6 (A:) Serine acetyltransferase {Haemophilus influenzae}
mtldvwqhirqeakelaenepmlasffhstilkhqnlggalsyllanklanpimpaislr
eiieeayqsnpsiidcaacdiqavrhrdpavelwstpllylkgfhaiqsyrithylwnqn
rkslalylqnqisvafdvdihpaakighgimfdhatgivvgetsviendvsilqgvtlgg
tgkesgdrhpkvregvmigagakilgnievgkyakigansvvlnpvpeyataagvpariv

SCOP Domain Coordinates for d1ssma_:

Click to download the PDB-style file with coordinates for d1ssma_.
(The format of our PDB-style files is described here.)

Timeline for d1ssma_: