Lineage for d1sska1 (1ssk A:5-158)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.148: Coronavirus RNA-binding domain [110303] (1 superfamily)
    coiled antiparallel beta-sheet of 5 strands, order 51324; complex topology, crossing loops
  4. Superfamily b.148.1: Coronavirus RNA-binding domain [110304] (1 family) (S)
    automatically mapped to Pfam PF00937
  5. Family b.148.1.1: Coronavirus RNA-binding domain [110305] (1 protein)
    N-terminal part of Pfam PF00937
  6. Protein Nucleocapsid protein [110306] (2 species)
  7. Species SARS coronavirus, (SARS-CoV) [TaxId:227859] [110307] (1 PDB entry)
    Uniprot P59595 45-181
  8. Domain d1sska1: 1ssk A:5-158 [105986]
    Other proteins in same PDB: d1sska2

Details for d1sska1

PDB Entry: 1ssk (more details)

PDB Description: Structure of the N-terminal RNA-binding Domain of the SARS CoV Nucleocapsid Protein
PDB Compounds: (A:) nucleocapsid protein

SCOPe Domain Sequences for d1sska1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sska1 b.148.1.1 (A:5-158) Nucleocapsid protein {SARS coronavirus, (SARS-CoV) [TaxId: 227859]}
hhhhhhssglvprgsamglpnntaswftaltqhgkeelrfprgqgvpintnsgpddqigy
yrratrrvrggdgkmkelsprwyfyylgtgpeaslpygankegivwvategalntpkdhi
gtrnpnnnaatvlqlpqgttlpkgfyaegsrggs

SCOPe Domain Coordinates for d1sska1 are not available.

Timeline for d1sska1:

Domains from same chain:
(mouse over for more information)
d1sska2