SCOPe 2.06: Domain d1ssga_: 1ssg A:

Lineage for d1ssga_ (1ssg A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families)

5. Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 proteins)
   automatically mapped to Pfam PF00121

6. Protein Triosephosphate isomerase [51353] (20 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [51354] (17 PDB entries)
   Uniprot P00940

8. Domain d1ssga_: 1ssg A: [105984]
   complexed with gol, pga, so4; mutant

Details for d1ssga_

PDB Entry: 1ssg, 2.9 Å

PDB Description: understanding protein lids: structural analysis of active hinge mutants in triosephosphate isomerase

PDB Compounds: (A:) triosephosphate isomerase

SCOPe Domain Sequences for d1ssga_:

Sequence; same for both SEQRES and ATOM records:

>d1ssga_ c.1.1.1 (A:) Triosephosphate isomerase {Chicken (Gallus gallus) [TaxId: 9031]}
aprkffvggnwkmngdkkslgelihtlngaklsadtevvcgapsiyldfarqkldakigv
aaqncykvpkgaftgeispamikdigaawvilghserrhvfgesdeligqkvahalaegl
gviacigekldereagitekvvfeqtkaiadnvkdwskvvlayepvwaigtgysltpqqa
qevheklrgwlkshvsdavaqstriiyggsvtggnckelasqhdvdgflvggaslkpefv
diinakh

Timeline for d1ssga_:

• d1ssga_ first appeared in SCOP 1.69
  
• d1ssga_ appears in SCOPe 2.05
  
• d1ssga_ appears in SCOPe 2.07
  
• d1ssga_ appears in the current release, SCOPe 2.08