Lineage for d1ssga_ (1ssg A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2826026Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 2826027Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 proteins)
    automatically mapped to Pfam PF00121
  6. 2826028Protein Triosephosphate isomerase [51353] (21 species)
  7. 2826060Species Chicken (Gallus gallus) [TaxId:9031] [51354] (17 PDB entries)
    Uniprot P00940
  8. 2826093Domain d1ssga_: 1ssg A: [105984]
    complexed with gol, pga, so4; mutant

Details for d1ssga_

PDB Entry: 1ssg (more details), 2.9 Å

PDB Description: understanding protein lids: structural analysis of active hinge mutants in triosephosphate isomerase
PDB Compounds: (A:) triosephosphate isomerase

SCOPe Domain Sequences for d1ssga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ssga_ c.1.1.1 (A:) Triosephosphate isomerase {Chicken (Gallus gallus) [TaxId: 9031]}
aprkffvggnwkmngdkkslgelihtlngaklsadtevvcgapsiyldfarqkldakigv
aaqncykvpkgaftgeispamikdigaawvilghserrhvfgesdeligqkvahalaegl
gviacigekldereagitekvvfeqtkaiadnvkdwskvvlayepvwaigtgysltpqqa
qevheklrgwlkshvsdavaqstriiyggsvtggnckelasqhdvdgflvggaslkpefv
diinakh

SCOPe Domain Coordinates for d1ssga_:

Click to download the PDB-style file with coordinates for d1ssga_.
(The format of our PDB-style files is described here.)

Timeline for d1ssga_: