| Class b: All beta proteins [48724] (174 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) ![]() |
| Family b.34.9.1: Tudor domain [63749] (8 proteins) Pfam PF00567 |
| Protein p53-binding protein 1, 53BP1 [110163] (1 species) duplication; contains two Tudor domains in tandem |
| Species Human (Homo sapiens) [TaxId:9606] [110164] (4 PDB entries) Uniprot Q12888 1485-1602 ! Uniprot Q12888 1484-1606 |
| Domain d1ssfa2: 1ssf A:61-129 [105983] |
PDB Entry: 1ssf (more details)
SCOPe Domain Sequences for d1ssfa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ssfa2 b.34.9.1 (A:61-129) p53-binding protein 1, 53BP1 {Human (Homo sapiens) [TaxId: 9606]}
ipldtevtalsedeyfsagvvkghrkesgelyysiekegqrkwykrmavilsleqgnrlr
eqyglgpye
Timeline for d1ssfa2: