Lineage for d1ssfa2 (1ssf A:61-129)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 557280Fold b.34: SH3-like barrel [50036] (15 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 557875Superfamily b.34.9: Tudor/PWWP/MBT [63748] (3 families) (S)
  5. 557876Family b.34.9.1: Tudor domain [63749] (2 proteins)
    Pfam 00567
  6. 557877Protein p53-binding protein 1, 53BP1 [110163] (1 species)
    duplication; contains two Tudor domains in tandem
  7. 557878Species Human (Homo sapiens) [TaxId:9606] [110164] (2 PDB entries)
  8. 557900Domain d1ssfa2: 1ssf A:61-129 [105983]

Details for d1ssfa2

PDB Entry: 1ssf (more details)

PDB Description: solution structure of the mouse 53bp1 fragment (residues 1463-1617)

SCOP Domain Sequences for d1ssfa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ssfa2 b.34.9.1 (A:61-129) p53-binding protein 1, 53BP1 {Human (Homo sapiens)}
ipldtevtalsedeyfsagvvkghrkesgelyysiekegqrkwykrmavilsleqgnrlr
eqyglgpye

SCOP Domain Coordinates for d1ssfa2:

Click to download the PDB-style file with coordinates for d1ssfa2.
(The format of our PDB-style files is described here.)

Timeline for d1ssfa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ssfa1