SCOPe 2.06: Domain d1ssfa1: 1ssf A:7-60

Lineage for d1ssfa1 (1ssf A:7-60)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families)

5. Family b.34.9.1: Tudor domain [63749] (8 proteins)
   Pfam PF00567

6. Protein p53-binding protein 1, 53BP1 [110163] (1 species)
   duplication; contains two Tudor domains in tandem

7. Species Human (Homo sapiens) [TaxId:9606] [110164] (7 PDB entries)
   Uniprot Q12888 1485-1602 ! Uniprot Q12888 1484-1606

8. Domain d1ssfa1: 1ssf A:7-60 [105982]

Details for d1ssfa1

PDB Entry: 1ssf

PDB Description: solution structure of the mouse 53bp1 fragment (residues 1463-1617)

PDB Compounds: (A:) Transformation related protein 53 binding protein 1

SCOPe Domain Sequences for d1ssfa1:

Sequence; same for both SEQRES and ATOM records:

>d1ssfa1 b.34.9.1 (A:7-60) p53-binding protein 1, 53BP1 {Human (Homo sapiens) [TaxId: 9606]}
nsfvglrvvakwssngyfysgkitrdvgagkykllfddgyecdvlgkdillcdp

Timeline for d1ssfa1:

• d1ssfa1 first appeared in SCOP 1.69
  
• d1ssfa1 appears in SCOPe 2.05
  
• d1ssfa1 appears in SCOPe 2.07
  
• d1ssfa1 appears in the current release, SCOPe 2.08