Lineage for d1ssfa1 (1ssf A:7-60)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 461193Fold b.34: SH3-like barrel [50036] (15 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 461769Superfamily b.34.9: Tudor/PWWP/MBT [63748] (3 families) (S)
  5. 461770Family b.34.9.1: Tudor domain [63749] (2 proteins)
    Pfam 00567
  6. 461771Protein p53-binding protein 1, 53BP1 [110163] (1 species)
    duplication; contains two Tudor domains in tandem
  7. 461772Species Human (Homo sapiens) [TaxId:9606] [110164] (1 PDB entry)
  8. 461773Domain d1ssfa1: 1ssf A:7-60 [105982]

Details for d1ssfa1

PDB Entry: 1ssf (more details)

PDB Description: Solution structure of the mouse 53BP1 fragment (residues 1463-1617)

SCOP Domain Sequences for d1ssfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ssfa1 b.34.9.1 (A:7-60) p53-binding protein 1, 53BP1 {Human (Homo sapiens)}
nsfvglrvvakwssngyfysgkitrdvgagkykllfddgyecdvlgkdillcdp

SCOP Domain Coordinates for d1ssfa1:

Click to download the PDB-style file with coordinates for d1ssfa1.
(The format of our PDB-style files is described here.)

Timeline for d1ssfa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ssfa2