SCOPe 2.08: Domain d1sse.1: 1sse A:,B:

Lineage for d1sse.1 (1sse A:,B:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.78: YAP1 redox domain [111429] (1 superfamily)
   bipartite cysteine-rich all-alpha domain; a single helix in the N-terminal part (chain A) is linked by disulfides to the C-terminal part (chain B) [3-helical bundle of the RuvA C-terminal domain-like fold (46928)

4. Superfamily g.78.1: YAP1 redox domain [111430] (1 family)
   automatically mapped to Pfam PF08601

5. Family g.78.1.1: YAP1 redox domain [111431] (1 protein)

6. Protein YAP1 redox domain [111432] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [111433] (1 PDB entry)
   Uniprot P19880 279-313,565-650

8. Domain d1sse.1: 1sse A:,B: [105981]

Details for d1sse.1

PDB Entry: 1sse

PDB Description: solution structure of the oxidized form of the yap1 redox domain

PDB Compounds: (A:) AP-1 like transcription factor YAP1, (B:) AP-1 like transcription factor YAP1

SCOPe Domain Sequences for d1sse.1:

Sequence; same for both SEQRES and ATOM records:

>g1sse.1 g.78.1.1 (A:,B:) YAP1 redox domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nldsnmfsndfnfenqfdeqvsefcskmnqvcgtrXngsslqnadkinngndndndndvv
pskegsllrcseiwdritthpkysdidvdglcselmakakcsergvvinaedvqlalnkh
mn

Timeline for d1sse.1:

• d1sse.1 first appeared in SCOP 1.69
  
• d1sse.1 appears in SCOPe 2.07