Lineage for d1ssdb_ (1ssd B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1565957Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 1565958Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 proteins)
    automatically mapped to Pfam PF00121
  6. 1565959Protein Triosephosphate isomerase [51353] (20 species)
  7. 1565982Species Chicken (Gallus gallus) [TaxId:9031] [51354] (17 PDB entries)
    Uniprot P00940
  8. 1566005Domain d1ssdb_: 1ssd B: [105980]
    complexed with so4; mutant

Details for d1ssdb_

PDB Entry: 1ssd (more details), 2.9 Å

PDB Description: understanding protein lids: structural analysis of active hinge mutants in triosephosphate isomerase
PDB Compounds: (B:) triosephosphate isomerase

SCOPe Domain Sequences for d1ssdb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ssdb_ c.1.1.1 (B:) Triosephosphate isomerase {Chicken (Gallus gallus) [TaxId: 9031]}
aprkffvggnwkmngdkkslgelihtlngaklsadtevvcgapsiyldfarqkldakigv
aaqncykvpkgaftgeispamikdigaawvilghserrhvfgesdeligqkvahalaegl
gviacigekldereagitekvvfeqtkaiadnvkdwskvvlayepvwaigtgysltpqqa
qevheklrgwlkshvsdavaqstriiyggsvtggnckelasqhdvdgflvggaslkpefv
diinakh

SCOPe Domain Coordinates for d1ssdb_:

Click to download the PDB-style file with coordinates for d1ssdb_.
(The format of our PDB-style files is described here.)

Timeline for d1ssdb_: