Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) |
Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 proteins) automatically mapped to Pfam PF00121 |
Protein Triosephosphate isomerase [51353] (20 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [51354] (17 PDB entries) Uniprot P00940 |
Domain d1ssdb_: 1ssd B: [105980] complexed with so4; mutant |
PDB Entry: 1ssd (more details), 2.9 Å
SCOPe Domain Sequences for d1ssdb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ssdb_ c.1.1.1 (B:) Triosephosphate isomerase {Chicken (Gallus gallus) [TaxId: 9031]} aprkffvggnwkmngdkkslgelihtlngaklsadtevvcgapsiyldfarqkldakigv aaqncykvpkgaftgeispamikdigaawvilghserrhvfgesdeligqkvahalaegl gviacigekldereagitekvvfeqtkaiadnvkdwskvvlayepvwaigtgysltpqqa qevheklrgwlkshvsdavaqstriiyggsvtggnckelasqhdvdgflvggaslkpefv diinakh
Timeline for d1ssdb_: