Lineage for d1ssdb_ (1ssd B:)
- Root: SCOP 1.71
Class c: Alpha and beta proteins (a/b) [51349] (134 folds) Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (1 family) 
Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein) Protein Triosephosphate isomerase [51353] (17 species) 
Species Chicken (Gallus gallus) [TaxId:9031] [51354] (16 PDB entries) 
Domain d1ssdb_: 1ssd B: [105980]
complexed with so4; mutant
Details for d1ssdb_
PDB Entry: 1ssd (more details), 2.9 Å
PDB Description: understanding protein lids: structural analysis of active hinge mutants in triosephosphate isomerase
SCOP Domain Sequences for d1ssdb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ssdb_ c.1.1.1 (B:) Triosephosphate isomerase {Chicken (Gallus gallus)}
aprkffvggnwkmngdkkslgelihtlngaklsadtevvcgapsiyldfarqkldakigv
aaqncykvpkgaftgeispamikdigaawvilghserrhvfgesdeligqkvahalaegl
gviacigekldereagitekvvfeqtkaiadnvkdwskvvlayepvwaigtgysltpqqa
qevheklrgwlkshvsdavaqstriiyggsvtggnckelasqhdvdgflvggaslkpefv
diinakh
SCOP Domain Coordinates for d1ssdb_:
Click to download the PDB-style file with coordinates for d1ssdb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ssdb_:
- d1ssdb_ first appeared in SCOP 1.69
- d1ssdb_ appears in SCOP 1.73
- d1ssdb_ appears in the current release, SCOPe 2.08
View in 3D
