Lineage for d1ss9a_ (1ss9 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2133075Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2133076Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2133191Family c.68.1.4: Galactosyltransferase LgtC [53458] (1 protein)
    automatically mapped to Pfam PF01501
  6. 2133192Protein Galactosyltransferase LgtC [53459] (1 species)
  7. 2133193Species Neisseria meningitidis [TaxId:487] [53460] (3 PDB entries)
    Uniprot Q93EK7
  8. 2133196Domain d1ss9a_: 1ss9 A: [105978]
    complexed with mn, upf; mutant

Details for d1ss9a_

PDB Entry: 1ss9 (more details), 2.6 Å

PDB Description: Crystal Structural Analysis of Active Site Mutant Q189E of LgtC
PDB Compounds: (A:) alpha-1,4-galactosyl transferase

SCOPe Domain Sequences for d1ss9a_:

Sequence, based on SEQRES records: (download)

>d1ss9a_ c.68.1.4 (A:) Galactosyltransferase LgtC {Neisseria meningitidis [TaxId: 487]}
mdivfaaddnyaaylcvaaksveaahpdteirfhvldagiseanraavaanlrggggnir
fidvnpedfagfplnirhisittyarlklgeyiadcdkvlyldidvlvrdsltplwdtdl
gdnwlgacidlfverqegykqkigmadgeyyfnagvllinlkkwrrhdifkmscewveqy
kdvmqyqdedilnglfkggvcyansrfnfmptnyafmanrfasrhtdplyrdrtntvmpv
avshycgpakpwhrdctawgaerftelagslttvpeewrgkl

Sequence, based on observed residues (ATOM records): (download)

>d1ss9a_ c.68.1.4 (A:) Galactosyltransferase LgtC {Neisseria meningitidis [TaxId: 487]}
mdivfaaddnyaaylcvaaksveaahpdteirfhvldagiseanraavaanlrggggnir
fidvnpedfagfplnirhisittyarlklgeyiadcdkvlyldidvlvrdsltplwdtdl
gdnwlgacidlfverqegykqkigmadgeyyfnagvllinlkkwrrhdifkmscewveqy
kdvmqyqdedilnglfkggvcyansrfnfmptnyafmanasrhtdplyrdrtntvmpvav
shycgpakpwhrdctawgaerftelagslttvpeewrgkl

SCOPe Domain Coordinates for d1ss9a_:

Click to download the PDB-style file with coordinates for d1ss9a_.
(The format of our PDB-style files is described here.)

Timeline for d1ss9a_: