Lineage for d1ss4b_ (1ss4 B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2549433Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2549434Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2549904Family d.32.1.6: Hypothetical protein BC1747 [110880] (1 protein)
    subunit fold and dimeric assembly are similar to those of glyoxalase
    automatically mapped to Pfam PF00903
  6. 2549905Protein Hypothetical protein BC1747 [110881] (1 species)
  7. 2549906Species Bacillus cereus (strain ATCC 14579 / DSM 31) [TaxId:226900] [110882] (1 PDB entry)
    Uniprot Q81F54
  8. 2549908Domain d1ss4b_: 1ss4 B: [105977]
    Other proteins in same PDB: d1ss4a2
    complexed with act, cit, fmt, gsh, mg, na

Details for d1ss4b_

PDB Entry: 1ss4 (more details), 1.84 Å

PDB Description: Crystal Structure of the Glyoxalase Family Protein APC24694 from Bacillus cereus
PDB Compounds: (B:) Glyoxalase family protein

SCOPe Domain Sequences for d1ss4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ss4b_ d.32.1.6 (B:) Hypothetical protein BC1747 {Bacillus cereus (strain ATCC 14579 / DSM 31) [TaxId: 226900]}
nkllrmdnvsivvesldnaisffeeiglnlegranvegewagrvtglgsqcveiammvtp
dghsrielsrfltpptiadhrtapvnalgylrvmftvedidemvsrltkhgaelvgevvq
yensyrlcyirgvegiliglaeelg

SCOPe Domain Coordinates for d1ss4b_:

Click to download the PDB-style file with coordinates for d1ss4b_.
(The format of our PDB-style files is described here.)

Timeline for d1ss4b_: