SCOP 1.69: Domain d1ss4b_: 1ss4 B:

Lineage for d1ss4b_ (1ss4 B:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (8 families)

5. Family d.32.1.6: Hypothetical protein BC1747 [110880] (1 protein)
   subunit fold and dimeric assembly are similar to those of glyoxalase

6. Protein Hypothetical protein BC1747 [110881] (1 species)

7. Species Bacillus cereus (strain ATCC 14579 / DSM 31) [TaxId:226900] [110882] (1 PDB entry)

8. Domain d1ss4b_: 1ss4 B: [105977]

Details for d1ss4b_

PDB Entry: 1ss4, 1.84 Å

PDB Description: Crystal Structure of the Glyoxalase Family Protein APC24694 from Bacillus cereus

SCOP Domain Sequences for d1ss4b_:

Sequence; same for both SEQRES and ATOM records:

>d1ss4b_ d.32.1.6 (B:) Hypothetical protein BC1747 {Bacillus cereus (strain ATCC 14579 / DSM 31)}
nkllrmdnvsivvesldnaisffeeiglnlegranvegewagrvtglgsqcveiammvtp
dghsrielsrfltpptiadhrtapvnalgylrvmftvedidemvsrltkhgaelvgevvq
yensyrlcyirgvegiliglaeelg

Timeline for d1ss4b_:

• d1ss4b_ is new in SCOP 1.69
  
• d1ss4b_ appears in SCOP 1.71
  
• d1ss4b_ appears in the current release, SCOPe 2.08