Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) |
Family d.32.1.6: Hypothetical protein BC1747 [110880] (1 protein) subunit fold and dimeric assembly are similar to those of glyoxalase automatically mapped to Pfam PF00903 |
Protein Hypothetical protein BC1747 [110881] (1 species) |
Species Bacillus cereus (strain ATCC 14579 / DSM 31) [TaxId:226900] [110882] (1 PDB entry) Uniprot Q81F54 |
Domain d1ss4b_: 1ss4 B: [105977] Other proteins in same PDB: d1ss4a2 complexed with act, cit, fmt, gsh, mg, na |
PDB Entry: 1ss4 (more details), 1.84 Å
SCOPe Domain Sequences for d1ss4b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ss4b_ d.32.1.6 (B:) Hypothetical protein BC1747 {Bacillus cereus (strain ATCC 14579 / DSM 31) [TaxId: 226900]} nkllrmdnvsivvesldnaisffeeiglnlegranvegewagrvtglgsqcveiammvtp dghsrielsrfltpptiadhrtapvnalgylrvmftvedidemvsrltkhgaelvgevvq yensyrlcyirgvegiliglaeelg
Timeline for d1ss4b_: