SCOPe 2.08: Domain d1ss4a1: 1ss4 A:1-148

Lineage for d1ss4a1 (1ss4 A:1-148)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.6: Hypothetical protein BC1747 [110880] (1 protein)
   subunit fold and dimeric assembly are similar to those of glyoxalase
   automatically mapped to Pfam PF00903

6. Protein Hypothetical protein BC1747 [110881] (1 species)

7. Species Bacillus cereus (strain ATCC 14579 / DSM 31) [TaxId:226900] [110882] (1 PDB entry)
   Uniprot Q81F54

8. Domain d1ss4a1: 1ss4 A:1-148 [105976]
   Other proteins in same PDB: d1ss4a2
   complexed with act, cit, fmt, gsh, mg, na

Details for d1ss4a1

PDB Entry: 1ss4, 1.84 Å

PDB Description: Crystal Structure of the Glyoxalase Family Protein APC24694 from Bacillus cereus

PDB Compounds: (A:) Glyoxalase family protein

SCOPe Domain Sequences for d1ss4a1:

Sequence; same for both SEQRES and ATOM records:

>d1ss4a1 d.32.1.6 (A:1-148) Hypothetical protein BC1747 {Bacillus cereus (strain ATCC 14579 / DSM 31) [TaxId: 226900]}
maknkllrmdnvsivvesldnaisffeeiglnlegranvegewagrvtglgsqcveiamm
vtpdghsrielsrfltpptiadhrtapvnalgylrvmftvedidemvsrltkhgaelvge
vvqyensyrlcyirgvegiliglaeelg

Timeline for d1ss4a1:

• d1ss4a1 first appeared in SCOP 1.69, called d1ss4a_
  
• d1ss4a1 appears in SCOPe 2.07