Lineage for d1sruc_ (1sru C:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1787538Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1788689Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1788761Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (13 proteins)
    barrel, closed; n=5, S=10
  6. 1788854Protein ssDNA-binding protein [50264] (4 species)
  7. 1788857Species Escherichia coli [TaxId:562] [50266] (6 PDB entries)
    Uniprot P02339
  8. 1788880Domain d1sruc_: 1sru C: [105973]

Details for d1sruc_

PDB Entry: 1sru (more details), 3.3 Å

PDB Description: Crystal structure of full length E. coli SSB protein
PDB Compounds: (C:) Single-strand binding protein

SCOPe Domain Sequences for d1sruc_:

Sequence, based on SEQRES records: (download)

>d1sruc_ b.40.4.3 (C:) ssDNA-binding protein {Escherichia coli [TaxId: 562]}
asrgvnkvilvgnlgqdpevrympnggavanitlatseswrdkatgemkeqtewhrvvlf
gklaevaseylrkgsqvyiegqlrtrkwtdqsgqdryttevvvnvggtmqml

Sequence, based on observed residues (ATOM records): (download)

>d1sruc_ b.40.4.3 (C:) ssDNA-binding protein {Escherichia coli [TaxId: 562]}
asrgvnkvilvgnlgqdpevryavanitlatsesweqtewhrvvlfgklaevaseylrkg
sqvyiegqlrtrkwtdqsdryttevvvnvggtmqml

SCOPe Domain Coordinates for d1sruc_:

Click to download the PDB-style file with coordinates for d1sruc_.
(The format of our PDB-style files is described here.)

Timeline for d1sruc_: