SCOPe 2.08: Domain d1srqd_: 1srq D:

Lineage for d1srqd_ (1srq D:)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.55: Rap/Ran-GAP [111346] (1 superfamily)
   consists of two domains; d1: alpha+beta (78-190; alpha-beta(4)-alpha-beta-alpha; 3 layers; antiparallel beta-sheet of 5 strands; order 51234); d2: alpha/beta similar to the G-domain fold (191-381; (52592))

4. Superfamily e.55.1: Rap/Ran-GAP [111347] (1 family)

5. Family e.55.1.1: Rap/Ran-GAP [111348] (1 protein)
   Pfam PF02145

6. Protein Rap1 GTPase-activating protein 1, Rap1GAP [111349] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [111350] (1 PDB entry)
   Uniprot P47736

8. Domain d1srqd_: 1srq D: [105970]
   chain D is disordered in the crystal
   complexed with mpd, so4
   fragment; missing more than one-third of the common structure and/or sequence

Details for d1srqd_

PDB Entry: 1srq, 2.9 Å

PDB Description: Crystal Structure of the Rap1GAP catalytic domain

PDB Compounds: (D:) GTPase-activating protein 1

SCOPe Domain Sequences for d1srqd_:

Sequence, based on SEQRES records:

>d1srqd_ e.55.1.1 (D:) Rap1 GTPase-activating protein 1, Rap1GAP {Human (Homo sapiens) [TaxId: 9606]}
yrkhflgkehfnyysldtalghlvfslkydvigdqehlrlllrtkcrtyhdvipisclte
fpnvvqmaklvcedvnvdrfypvlypkasrlivtfdehvisnnfkfgviyqklgqtseee
lfstneespafvefleflgqkvklqdfkgfrggldvthgqtgtesvycnfrnkeimfhvs
tklpytegdaqqlqrkrhigndivavvfqdentpfvpdmiasnflhayvvvqaegggpdg
plykvsvtarddvpffgpplpdpavfrkgpefqeflltklinaeyacykaekfakleert
raalletlyeelhihsqsmm

Sequence, based on observed residues (ATOM records):

>d1srqd_ e.55.1.1 (D:) Rap1 GTPase-activating protein 1, Rap1GAP {Human (Homo sapiens) [TaxId: 9606]}
yrkhflgkehfnyyvfslkydvhlrlllpnvvrfypvlypkasrlivtfdeetlyeelhi
hsqsmm

Timeline for d1srqd_:

• d1srqd_ first appeared in SCOP 1.69
  
• d1srqd_ appears in SCOPe 2.07