![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds) |
![]() | Fold e.55: Rap/Ran-GAP [111346] (1 superfamily) consists of two domains; d1: alpha+beta (78-190; alpha-beta(4)-alpha-beta-alpha; 3 layers; antiparallel beta-sheet of 5 strands; order 51234); d2: alpha/beta similar to the G-domain fold (191-381; (52592)) |
![]() | Superfamily e.55.1: Rap/Ran-GAP [111347] (1 family) ![]() |
![]() | Family e.55.1.1: Rap/Ran-GAP [111348] (1 protein) Pfam PF02145 |
![]() | Protein Rap1 GTPase-activating protein 1, Rap1GAP [111349] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [111350] (1 PDB entry) Uniprot P47736 |
![]() | Domain d1srqc_: 1srq C: [105969] chain D is disordered in the crystal complexed with mpd, so4 |
PDB Entry: 1srq (more details), 2.9 Å
SCOPe Domain Sequences for d1srqc_:
Sequence, based on SEQRES records: (download)
>d1srqc_ e.55.1.1 (C:) Rap1 GTPase-activating protein 1, Rap1GAP {Human (Homo sapiens) [TaxId: 9606]} tkvklecnptariyrkhflgkehfnyysldtalghlvfslkydvigdqehlrlllrtkcr tyhdvipiscltefpnvvqmaklvcedvnvdrfypvlypkasrlivtfdehvisnnfkfg viyqklgqtseeelfstneespafvefleflgqkvklqdfkgfrggldvthgqtgtesvy cnfrnkeimfhvstklpytegdaqqlqrkrhigndivavvfqdentpfvpdmiasnflha yvvvqaegggpdgplykvsvtarddvpffgpplpdpavfrkgpefqeflltklinaeyac ykaekfakleertraalletlyeelhihsqsmm
>d1srqc_ e.55.1.1 (C:) Rap1 GTPase-activating protein 1, Rap1GAP {Human (Homo sapiens) [TaxId: 9606]} tkvklecnptariyrkhflgkehfnyysldtalghlvfslkydvigdqehlrlllrtkcr tyhdvipitefpnvvqmaklvcedvnvdrfypvlypkasrlivtfdehvisnnfkfgviy qklgqtseeelfstneespafvefleflgqkvklqdfkgfrggldvthgqtgtesvycnf rnkeimfhvstklpytegdaqqlqrkrhigndivavvfqdentpfvpdmiasnflhayvv vqaeplykvsvtarddvpffgpplpdpavfrkgpefqeflltklinaeyacykaekfakl eertraalletlyeelhihsqsmm
Timeline for d1srqc_: