Lineage for d1srqc_ (1srq C:)

  1. Root: SCOP 1.69
  2. 517079Class e: Multi-domain proteins (alpha and beta) [56572] (46 folds)
  3. 519068Fold e.55: Rap/Ran-GAP (Pfam 02145) [111346] (1 superfamily)
    consists of two domains; d1: alpha+beta (78-190; alpha-beta(4)-alpha-beta-alpha; 3 layers; antiparallel beta-sheet of 5 strands; order 51234); d2: alpha/beta similar to the G-domain fold (191-381; scop_fa 52592)
  4. 519069Superfamily e.55.1: Rap/Ran-GAP (Pfam 02145) [111347] (1 family) (S)
  5. 519070Family e.55.1.1: Rap/Ran-GAP (Pfam 02145) [111348] (1 protein)
  6. 519071Protein Rap1 GTPase-activating protein 1, Rap1GAP [111349] (1 species)
  7. 519072Species Human (Homo sapiens) [TaxId:9606] [111350] (1 PDB entry)
  8. 519075Domain d1srqc_: 1srq C: [105969]

Details for d1srqc_

PDB Entry: 1srq (more details), 2.9 Å

PDB Description: Crystal Structure of the Rap1GAP catalytic domain

SCOP Domain Sequences for d1srqc_:

Sequence, based on SEQRES records: (download)

>d1srqc_ e.55.1.1 (C:) Rap1 GTPase-activating protein 1, Rap1GAP {Human (Homo sapiens)}
tkvklecnptariyrkhflgkehfnyysldtalghlvfslkydvigdqehlrlllrtkcr
tyhdvipiscltefpnvvqmaklvcedvnvdrfypvlypkasrlivtfdehvisnnfkfg
viyqklgqtseeelfstneespafvefleflgqkvklqdfkgfrggldvthgqtgtesvy
cnfrnkeimfhvstklpytegdaqqlqrkrhigndivavvfqdentpfvpdmiasnflha
yvvvqaegggpdgplykvsvtarddvpffgpplpdpavfrkgpefqeflltklinaeyac
ykaekfakleertraalletlyeelhihsqsmm

Sequence, based on observed residues (ATOM records): (download)

>d1srqc_ e.55.1.1 (C:) Rap1 GTPase-activating protein 1, Rap1GAP {Human (Homo sapiens)}
tkvklecnptariyrkhflgkehfnyysldtalghlvfslkydvigdqehlrlllrtkcr
tyhdvipitefpnvvqmaklvcedvnvdrfypvlypkasrlivtfdehvisnnfkfgviy
qklgqtseeelfstneespafvefleflgqkvklqdfkgfrggldvthgqtgtesvycnf
rnkeimfhvstklpytegdaqqlqrkrhigndivavvfqdentpfvpdmiasnflhayvv
vqaeplykvsvtarddvpffgpplpdpavfrkgpefqeflltklinaeyacykaekfakl
eertraalletlyeelhihsqsmm

SCOP Domain Coordinates for d1srqc_:

Click to download the PDB-style file with coordinates for d1srqc_.
(The format of our PDB-style files is described here.)

Timeline for d1srqc_: